Brand: | Abnova |
Reference: | H00011095-M01 |
Product name: | ADAMTS8 monoclonal antibody (M01), clone 5A3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAMTS8. |
Clone: | 5A3 |
Isotype: | IgG2a Kappa |
Gene id: | 11095 |
Gene name: | ADAMTS8 |
Gene alias: | ADAM-TS8|FLJ41712|METH2 |
Gene description: | ADAM metallopeptidase with thrombospondin type 1 motif, 8 |
Genbank accession: | NM_007037 |
Immunogen: | ADAMTS8 (NP_008968, 781 a.a. ~ 890 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL |
Protein accession: | NP_008968 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADAMTS8 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |