ADAMTS8 monoclonal antibody (M01), clone 5A3 View larger

ADAMTS8 monoclonal antibody (M01), clone 5A3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAMTS8 monoclonal antibody (M01), clone 5A3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ADAMTS8 monoclonal antibody (M01), clone 5A3

Brand: Abnova
Reference: H00011095-M01
Product name: ADAMTS8 monoclonal antibody (M01), clone 5A3
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAMTS8.
Clone: 5A3
Isotype: IgG2a Kappa
Gene id: 11095
Gene name: ADAMTS8
Gene alias: ADAM-TS8|FLJ41712|METH2
Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 8
Genbank accession: NM_007037
Immunogen: ADAMTS8 (NP_008968, 781 a.a. ~ 890 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RPLPEPLTVQLLTVPGEVFPPKVKYTFFVPNDVDFSMQSSKERATTNIIQPLLHAQWVLGDWSECSSTCGAGWQRRTVECRDPSGQASATCNKALKPEDAKPCESQLCPL
Protein accession: NP_008968
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011095-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011095-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ADAMTS8 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W.
FreshPatents.com

Reviews

Buy ADAMTS8 monoclonal antibody (M01), clone 5A3 now

Add to cart