Brand: | Abnova |
Reference: | H00011093-M06 |
Product name: | ADAMTS13 monoclonal antibody (M06), clone 4F12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ADAMTS13. |
Clone: | 4F12 |
Isotype: | IgG2b Kappa |
Gene id: | 11093 |
Gene name: | ADAMTS13 |
Gene alias: | C9orf8|DKFZp434C2322|FLJ42993|MGC118899|MGC118900|TTP|VWFCP|vWF-CP |
Gene description: | ADAM metallopeptidase with thrombospondin type 1 motif, 13 |
Genbank accession: | NM_139025 |
Immunogen: | ADAMTS13 (NP_620594, 1328 a.a. ~ 1427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT |
Protein accession: | NP_620594 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ADAMTS13 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |