ADAMTS13 monoclonal antibody (M06), clone 4F12 View larger

ADAMTS13 monoclonal antibody (M06), clone 4F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAMTS13 monoclonal antibody (M06), clone 4F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ADAMTS13 monoclonal antibody (M06), clone 4F12

Brand: Abnova
Reference: H00011093-M06
Product name: ADAMTS13 monoclonal antibody (M06), clone 4F12
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAMTS13.
Clone: 4F12
Isotype: IgG2b Kappa
Gene id: 11093
Gene name: ADAMTS13
Gene alias: C9orf8|DKFZp434C2322|FLJ42993|MGC118899|MGC118900|TTP|VWFCP|vWF-CP
Gene description: ADAM metallopeptidase with thrombospondin type 1 motif, 13
Genbank accession: NM_139025
Immunogen: ADAMTS13 (NP_620594, 1328 a.a. ~ 1427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQVLYWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEMQDPQSWKGKEGT
Protein accession: NP_620594
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011093-M06-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ADAMTS13 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ADAMTS13 monoclonal antibody (M06), clone 4F12 now

Add to cart