Brand: | Abnova |
Reference: | H00011091-M01A |
Product name: | WDR5 monoclonal antibody (M01A), clone 2C2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WDR5. |
Clone: | 2C2 |
Isotype: | IgG2b Kappa |
Gene id: | 11091 |
Gene name: | WDR5 |
Gene alias: | BIG-3|SWD3 |
Gene description: | WD repeat domain 5 |
Genbank accession: | NM_017588 |
Immunogen: | WDR5 (NP_060058, 16 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK |
Protein accession: | NP_060058 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | WDR5 monoclonal antibody (M01A), clone 2C2. Western Blot analysis of WDR5 expression in A-549 ( Cat # L025V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |