ADAM29 monoclonal antibody (M09), clone 3A6 View larger

ADAM29 monoclonal antibody (M09), clone 3A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAM29 monoclonal antibody (M09), clone 3A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ADAM29 monoclonal antibody (M09), clone 3A6

Brand: Abnova
Reference: H00011086-M09
Product name: ADAM29 monoclonal antibody (M09), clone 3A6
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAM29.
Clone: 3A6
Isotype: IgG1 Kappa
Gene id: 11086
Gene name: ADAM29
Gene alias: svph1
Gene description: ADAM metallopeptidase domain 29
Genbank accession: NM_014269
Immunogen: ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Protein accession: NP_055084
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011086-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.34 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011086-M09-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ADAM29 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: ADAM29 Expression in Human Breast Cancer and its Effects on Breast Cancer Cells In Vitro.Zhao M, Jia W, Jiang WG, Wang P, DU G, Cheng S, Song M.
Anticancer Res. 2016 Mar;36(3):1251-8.

Reviews

Buy ADAM29 monoclonal antibody (M09), clone 3A6 now

Add to cart