ADAM29 monoclonal antibody (M01A), clone 1F6 View larger

ADAM29 monoclonal antibody (M01A), clone 1F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAM29 monoclonal antibody (M01A), clone 1F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about ADAM29 monoclonal antibody (M01A), clone 1F6

Brand: Abnova
Reference: H00011086-M01A
Product name: ADAM29 monoclonal antibody (M01A), clone 1F6
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAM29.
Clone: 1F6
Isotype: IgM Kappa
Gene id: 11086
Gene name: ADAM29
Gene alias: svph1
Gene description: ADAM metallopeptidase domain 29
Genbank accession: NM_014269
Immunogen: ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Protein accession: NP_055084
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy ADAM29 monoclonal antibody (M01A), clone 1F6 now

Add to cart