ADAM30 monoclonal antibody (M02), clone 3E5 View larger

ADAM30 monoclonal antibody (M02), clone 3E5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADAM30 monoclonal antibody (M02), clone 3E5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ADAM30 monoclonal antibody (M02), clone 3E5

Brand: Abnova
Reference: H00011085-M02
Product name: ADAM30 monoclonal antibody (M02), clone 3E5
Product description: Mouse monoclonal antibody raised against a partial recombinant ADAM30.
Clone: 3E5
Isotype: IgG2b Kappa
Gene id: 11085
Gene name: ADAM30
Gene alias: svph4
Gene description: ADAM metallopeptidase domain 30
Genbank accession: NM_021794
Immunogen: ADAM30 (NP_068566, 199 a.a. ~ 298 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YKHPKYLELILLFDQSRYRFVNNNLSQVIHDAILLTGIMDTYFQDVRMRIHLKALEVWTDFNKIRVGYPELAEVLGRFVIYKKSVLNARLSSDWAHLYLQ
Protein accession: NP_068566
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011085-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ADAM30 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ADAM30 monoclonal antibody (M02), clone 3E5 now

Add to cart