DATF1 monoclonal antibody (M01A), clone 3E3 View larger

DATF1 monoclonal antibody (M01A), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DATF1 monoclonal antibody (M01A), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about DATF1 monoclonal antibody (M01A), clone 3E3

Brand: Abnova
Reference: H00011083-M01A
Product name: DATF1 monoclonal antibody (M01A), clone 3E3
Product description: Mouse monoclonal antibody raised against a partial recombinant DATF1.
Clone: 3E3
Isotype: IgM kappa
Gene id: 11083
Gene name: DIDO1
Gene alias: BYE1|C20orf158|DATF1|DIDO2|DIDO3|DIO-1|DIO1|DKFZp434P1115|FLJ11265|KIAA0333|MGC16140|dJ885L7.8
Gene description: death inducer-obliterator 1
Genbank accession: BC014489
Immunogen: DATF1 (AAH14489, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILK
Protein accession: AAH14489
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy DATF1 monoclonal antibody (M01A), clone 3E3 now

Add to cart