HSF2BP monoclonal antibody (M01), clone 1C4 View larger

HSF2BP monoclonal antibody (M01), clone 1C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HSF2BP monoclonal antibody (M01), clone 1C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,S-ELISA,ELISA

More info about HSF2BP monoclonal antibody (M01), clone 1C4

Brand: Abnova
Reference: H00011077-M01
Product name: HSF2BP monoclonal antibody (M01), clone 1C4
Product description: Mouse monoclonal antibody raised against a partial recombinant HSF2BP.
Clone: 1C4
Isotype: IgG2a Kappa
Gene id: 11077
Gene name: HSF2BP
Gene alias: -
Gene description: heat shock transcription factor 2 binding protein
Genbank accession: NM_007031
Immunogen: HSF2BP (NP_008962.1, 231 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
Protein accession: NP_008962.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011077-M01-2-A7-1.jpg
Application image note: HSF2BP monoclonal antibody (M01), clone 1C4. Western Blot analysis of HSF2BP expression in human pancreas.
Applications: WB-Ti,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy HSF2BP monoclonal antibody (M01), clone 1C4 now

Add to cart