Brand: | Abnova |
Reference: | H00011077-M01 |
Product name: | HSF2BP monoclonal antibody (M01), clone 1C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HSF2BP. |
Clone: | 1C4 |
Isotype: | IgG2a Kappa |
Gene id: | 11077 |
Gene name: | HSF2BP |
Gene alias: | - |
Gene description: | heat shock transcription factor 2 binding protein |
Genbank accession: | NM_007031 |
Immunogen: | HSF2BP (NP_008962.1, 231 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV |
Protein accession: | NP_008962.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | HSF2BP monoclonal antibody (M01), clone 1C4. Western Blot analysis of HSF2BP expression in human pancreas. |
Applications: | WB-Ti,S-ELISA,ELISA |
Shipping condition: | Dry Ice |