STMN2 monoclonal antibody (M05), clone 1D3 View larger

STMN2 monoclonal antibody (M05), clone 1D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STMN2 monoclonal antibody (M05), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about STMN2 monoclonal antibody (M05), clone 1D3

Brand: Abnova
Reference: H00011075-M05
Product name: STMN2 monoclonal antibody (M05), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant STMN2.
Clone: 1D3
Isotype: IgG2b Kappa
Gene id: 11075
Gene name: STMN2
Gene alias: SCG10|SCGN10|SGC10
Gene description: stathmin-like 2
Genbank accession: NM_007029
Immunogen: STMN2 (NP_008960, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Protein accession: NP_008960
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011075-M05-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged STMN2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy STMN2 monoclonal antibody (M05), clone 1D3 now

Add to cart