STMN2 monoclonal antibody (M04A), clone 3E4 View larger

STMN2 monoclonal antibody (M04A), clone 3E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STMN2 monoclonal antibody (M04A), clone 3E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about STMN2 monoclonal antibody (M04A), clone 3E4

Brand: Abnova
Reference: H00011075-M04A
Product name: STMN2 monoclonal antibody (M04A), clone 3E4
Product description: Mouse monoclonal antibody raised against a partial recombinant STMN2.
Clone: 3E4
Isotype: IgM Kappa
Gene id: 11075
Gene name: STMN2
Gene alias: SCG10|SCGN10|SGC10
Gene description: stathmin-like 2
Genbank accession: NM_007029
Immunogen: STMN2 (NP_008960, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA
Protein accession: NP_008960
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy STMN2 monoclonal antibody (M04A), clone 3E4 now

Add to cart