Brand: | Abnova |
Reference: | H00011075-M04A |
Product name: | STMN2 monoclonal antibody (M04A), clone 3E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant STMN2. |
Clone: | 3E4 |
Isotype: | IgM Kappa |
Gene id: | 11075 |
Gene name: | STMN2 |
Gene alias: | SCG10|SCGN10|SGC10 |
Gene description: | stathmin-like 2 |
Genbank accession: | NM_007029 |
Immunogen: | STMN2 (NP_008960, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKPPSPISEAPRTLASPKKKDLSLEEIQKKLEA |
Protein accession: | NP_008960 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |