Brand: | Abnova |
Reference: | H00011074-M03 |
Product name: | TRIM31 monoclonal antibody (M03), clone 2G11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TRIM31. |
Clone: | 2G11 |
Isotype: | IgG2a Kappa |
Gene id: | 11074 |
Gene name: | TRIM31 |
Gene alias: | C6orf13|HCG1|HCGI|RNF |
Gene description: | tripartite motif-containing 31 |
Genbank accession: | NM_007028 |
Immunogen: | TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE |
Protein accession: | NP_008959 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TRIM31 is 3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |