TRIM31 monoclonal antibody (M03), clone 2G11 View larger

TRIM31 monoclonal antibody (M03), clone 2G11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TRIM31 monoclonal antibody (M03), clone 2G11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about TRIM31 monoclonal antibody (M03), clone 2G11

Brand: Abnova
Reference: H00011074-M03
Product name: TRIM31 monoclonal antibody (M03), clone 2G11
Product description: Mouse monoclonal antibody raised against a partial recombinant TRIM31.
Clone: 2G11
Isotype: IgG2a Kappa
Gene id: 11074
Gene name: TRIM31
Gene alias: C6orf13|HCG1|HCGI|RNF
Gene description: tripartite motif-containing 31
Genbank accession: NM_007028
Immunogen: TRIM31 (NP_008959, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSVRKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQE
Protein accession: NP_008959
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011074-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged TRIM31 is 3 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy TRIM31 monoclonal antibody (M03), clone 2G11 now

Add to cart