TOPBP1 monoclonal antibody (M04), clone 6D12 View larger

TOPBP1 monoclonal antibody (M04), clone 6D12

H00011073-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TOPBP1 monoclonal antibody (M04), clone 6D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about TOPBP1 monoclonal antibody (M04), clone 6D12

Brand: Abnova
Reference: H00011073-M04
Product name: TOPBP1 monoclonal antibody (M04), clone 6D12
Product description: Mouse monoclonal antibody raised against a partial recombinant TOPBP1.
Clone: 6D12
Isotype: IgG2a Kappa
Gene id: 11073
Gene name: TOPBP1
Gene alias: TOP2BP1
Gene description: topoisomerase (DNA) II binding protein 1
Genbank accession: NM_007027
Immunogen: TOPBP1 (NP_008958, 1327 a.a. ~ 1435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH
Protein accession: NP_008958
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011073-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011073-M04-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TOPBP1 is 0.03 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TOPBP1 monoclonal antibody (M04), clone 6D12 now

Add to cart