Brand: | Abnova |
Reference: | H00011073-M04 |
Product name: | TOPBP1 monoclonal antibody (M04), clone 6D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TOPBP1. |
Clone: | 6D12 |
Isotype: | IgG2a Kappa |
Gene id: | 11073 |
Gene name: | TOPBP1 |
Gene alias: | TOP2BP1 |
Gene description: | topoisomerase (DNA) II binding protein 1 |
Genbank accession: | NM_007027 |
Immunogen: | TOPBP1 (NP_008958, 1327 a.a. ~ 1435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH |
Protein accession: | NP_008958 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged TOPBP1 is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |