DUSP14 monoclonal antibody (M03), clone 4F6 View larger

DUSP14 monoclonal antibody (M03), clone 4F6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP14 monoclonal antibody (M03), clone 4F6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about DUSP14 monoclonal antibody (M03), clone 4F6

Brand: Abnova
Reference: H00011072-M03
Product name: DUSP14 monoclonal antibody (M03), clone 4F6
Product description: Mouse monoclonal antibody raised against a full-length recombinant DUSP14.
Clone: 4F6
Isotype: IgG2b Kappa
Gene id: 11072
Gene name: DUSP14
Gene alias: MKP-L|MKP6
Gene description: dual specificity phosphatase 14
Genbank accession: BC000370
Immunogen: DUSP14 (AAH00370, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Protein accession: AAH00370
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy DUSP14 monoclonal antibody (M03), clone 4F6 now

Add to cart