DUSP14 monoclonal antibody (M02), clone 4B5-E6 View larger

DUSP14 monoclonal antibody (M02), clone 4B5-E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP14 monoclonal antibody (M02), clone 4B5-E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about DUSP14 monoclonal antibody (M02), clone 4B5-E6

Brand: Abnova
Reference: H00011072-M02
Product name: DUSP14 monoclonal antibody (M02), clone 4B5-E6
Product description: Mouse monoclonal antibody raised against a full length recombinant DUSP14.
Clone: 4B5-E6
Isotype: IgG2a kappa
Gene id: 11072
Gene name: DUSP14
Gene alias: MKP-L|MKP6
Gene description: dual specificity phosphatase 14
Genbank accession: BC000370
Immunogen: DUSP14 (AAH00370, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Protein accession: AAH00370
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011072-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (47.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged DUSP14 is approximately 30ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DUSP14 monoclonal antibody (M02), clone 4B5-E6 now

Add to cart