Brand: | Abnova |
Reference: | H00011072-A01 |
Product name: | DUSP14 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant DUSP14. |
Gene id: | 11072 |
Gene name: | DUSP14 |
Gene alias: | MKP-L|MKP6 |
Gene description: | dual specificity phosphatase 14 |
Genbank accession: | BC000370 |
Immunogen: | DUSP14 (AAH00370, 1 a.a. ~ 198 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI |
Protein accession: | AAH00370 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (47.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |