Brand: | Abnova |
Reference: | H00011069-M01 |
Product name: | RAPGEF4 monoclonal antibody (M01), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAPGEF4. |
Clone: | 1C11 |
Isotype: | IgG2b Kappa |
Gene id: | 11069 |
Gene name: | RAPGEF4 |
Gene alias: | CAMP-GEFII|CGEF2|EPAC2|Nbla00496 |
Gene description: | Rap guanine nucleotide exchange factor (GEF) 4 |
Genbank accession: | BC024004 |
Immunogen: | RAPGEF4 (AAH24004, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIG |
Protein accession: | AAH24004 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RAPGEF4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |