RAPGEF4 monoclonal antibody (M01), clone 1C11 View larger

RAPGEF4 monoclonal antibody (M01), clone 1C11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAPGEF4 monoclonal antibody (M01), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about RAPGEF4 monoclonal antibody (M01), clone 1C11

Brand: Abnova
Reference: H00011069-M01
Product name: RAPGEF4 monoclonal antibody (M01), clone 1C11
Product description: Mouse monoclonal antibody raised against a partial recombinant RAPGEF4.
Clone: 1C11
Isotype: IgG2b Kappa
Gene id: 11069
Gene name: RAPGEF4
Gene alias: CAMP-GEFII|CGEF2|EPAC2|Nbla00496
Gene description: Rap guanine nucleotide exchange factor (GEF) 4
Genbank accession: BC024004
Immunogen: RAPGEF4 (AAH24004, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPNLLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQDAVTICTLGIG
Protein accession: AAH24004
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011069-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011069-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged RAPGEF4 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAPGEF4 monoclonal antibody (M01), clone 1C11 now

Add to cart