C10orf10 purified MaxPab mouse polyclonal antibody (B01P) View larger

C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C10orf10 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00011067-B01P
Product name: C10orf10 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C10orf10 protein.
Gene id: 11067
Gene name: C10orf10
Gene alias: DEPP|FIG
Gene description: chromosome 10 open reading frame 10
Genbank accession: NM_007021.2
Immunogen: C10orf10 (NP_008952.1, 1 a.a. ~ 212 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRSRLLLSVAHLPTIRETTEEMLLGGPGQEPPPSPSLDDYVRSISRLAQPTSVLDKATAQGQPRPPHRPAQACRKGRPAVSLRDITARFSGQQPTLPMADTVDPLDWLFGESQEKQPSQRDLPRRTGPSAGLWGPHRQMDSSKPMGAPRGRLCEARMPGHSLARPPQDGQQSSDLRSWTFGQSAQAMASRHRPRPSSVLRTLYSHLPVIHEL
Protein accession: NP_008952.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011067-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C10orf10 expression in transfected 293T cell line (H00011067-T02) by C10orf10 MaxPab polyclonal antibody.

Lane 1: C10orf10 transfected lysate(23.4 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C10orf10 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart