Brand: | Abnova |
Reference: | H00011065-M12 |
Product name: | UBE2C monoclonal antibody (M12), clone 1D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2C. |
Clone: | 1D8 |
Isotype: | IgG2b Kappa |
Gene id: | 11065 |
Gene name: | UBE2C |
Gene alias: | UBCH10|dJ447F3.2 |
Gene description: | ubiquitin-conjugating enzyme E2C |
Genbank accession: | BC016292 |
Immunogen: | UBE2C (AAH16292.1, 25 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR |
Protein accession: | AAH16292.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UBE2C is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |