UBE2C monoclonal antibody (M12), clone 1D8 View larger

UBE2C monoclonal antibody (M12), clone 1D8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2C monoclonal antibody (M12), clone 1D8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UBE2C monoclonal antibody (M12), clone 1D8

Brand: Abnova
Reference: H00011065-M12
Product name: UBE2C monoclonal antibody (M12), clone 1D8
Product description: Mouse monoclonal antibody raised against a partial recombinant UBE2C.
Clone: 1D8
Isotype: IgG2b Kappa
Gene id: 11065
Gene name: UBE2C
Gene alias: UBCH10|dJ447F3.2
Gene description: ubiquitin-conjugating enzyme E2C
Genbank accession: BC016292
Immunogen: UBE2C (AAH16292.1, 25 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVR
Protein accession: AAH16292.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011065-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011065-M12-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged UBE2C is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBE2C monoclonal antibody (M12), clone 1D8 now

Add to cart