Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011065-M04 |
Product name: | UBE2C monoclonal antibody (M04), clone 3B1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2C. |
Clone: | 3B1 |
Isotype: | IgG2a Kappa |
Gene id: | 11065 |
Gene name: | UBE2C |
Gene alias: | UBCH10|dJ447F3.2 |
Gene description: | ubiquitin-conjugating enzyme E2C |
Genbank accession: | BC050736 |
Immunogen: | UBE2C (AAH50736, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Protein accession: | AAH50736 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.43 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of UBE2C expression in transfected 293T cell line by UBE2C monoclonal antibody (M04), clone 3B1. Lane 1: UBE2C transfected lysate(19.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |