Brand: | Abnova |
Reference: | H00011065-M01 |
Product name: | UBE2C monoclonal antibody (M01), clone 9D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2C. |
Clone: | 9D3 |
Isotype: | IgG2a Kappa |
Gene id: | 11065 |
Gene name: | UBE2C |
Gene alias: | UBCH10|dJ447F3.2 |
Gene description: | ubiquitin-conjugating enzyme E2C |
Genbank accession: | NM_007019 |
Immunogen: | UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Protein accession: | NP_008950 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Association of clinicopathological features with UbcH10 expression in colorectal cancer.Chen S, Chen Y, Hu C, Jing H, Cao Y, Liu X. J Cancer Res Clin Oncol. 2009 Sep 25. [Epub ahead of print] |