UBE2C monoclonal antibody (M01), clone 9D3 View larger

UBE2C monoclonal antibody (M01), clone 9D3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2C monoclonal antibody (M01), clone 9D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about UBE2C monoclonal antibody (M01), clone 9D3

Brand: Abnova
Reference: H00011065-M01
Product name: UBE2C monoclonal antibody (M01), clone 9D3
Product description: Mouse monoclonal antibody raised against a partial recombinant UBE2C.
Clone: 9D3
Isotype: IgG2a Kappa
Gene id: 11065
Gene name: UBE2C
Gene alias: UBCH10|dJ447F3.2
Gene description: ubiquitin-conjugating enzyme E2C
Genbank accession: NM_007019
Immunogen: UBE2C (NP_008950, 70 a.a. ~ 179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Protein accession: NP_008950
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011065-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011065-M01-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to UBE2C on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Association of clinicopathological features with UbcH10 expression in colorectal cancer.Chen S, Chen Y, Hu C, Jing H, Cao Y, Liu X.
J Cancer Res Clin Oncol. 2009 Sep 25. [Epub ahead of print]

Reviews

Buy UBE2C monoclonal antibody (M01), clone 9D3 now

Add to cart