Brand: | Abnova |
Reference: | H00011065-A02 |
Product name: | UBE2C polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant UBE2C. |
Gene id: | 11065 |
Gene name: | UBE2C |
Gene alias: | UBCH10|dJ447F3.2 |
Gene description: | ubiquitin-conjugating enzyme E2C |
Genbank accession: | BC050736 |
Immunogen: | UBE2C (AAH50736, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP |
Protein accession: | AAH50736 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (45.8 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | UBE2C polyclonal antibody (A02), Lot # 051122JC01 Western Blot analysis of UBE2C expression in IMR-32 ( Cat # L008V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |