UBE2C polyclonal antibody (A01) View larger

UBE2C polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBE2C polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about UBE2C polyclonal antibody (A01)

Brand: Abnova
Reference: H00011065-A01
Product name: UBE2C polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant UBE2C.
Gene id: 11065
Gene name: UBE2C
Gene alias: UBCH10|dJ447F3.2
Gene description: ubiquitin-conjugating enzyme E2C
Genbank accession: BC016292
Immunogen: UBE2C (AAH16292, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Protein accession: AAH16292
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011065-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (45.8 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBE2C polyclonal antibody (A01) now

Add to cart