SOX30 monoclonal antibody (M02), clone 6H1 View larger

SOX30 monoclonal antibody (M02), clone 6H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX30 monoclonal antibody (M02), clone 6H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about SOX30 monoclonal antibody (M02), clone 6H1

Brand: Abnova
Reference: H00011063-M02
Product name: SOX30 monoclonal antibody (M02), clone 6H1
Product description: Mouse monoclonal antibody raised against a partial recombinant SOX30.
Clone: 6H1
Isotype: IgG2a Kappa
Gene id: 11063
Gene name: SOX30
Gene alias: -
Gene description: SRY (sex determining region Y)-box 30
Genbank accession: NM_178424
Immunogen: SOX30 (NP_848511, 644 a.a. ~ 753 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL
Protein accession: NP_848511
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011063-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011063-M02-4-7-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to SOX30 on MCF-7 cell . [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SOX30 monoclonal antibody (M02), clone 6H1 now

Add to cart