SOX30 polyclonal antibody (A01) View larger

SOX30 polyclonal antibody (A01)

H00011063-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOX30 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about SOX30 polyclonal antibody (A01)

Brand: Abnova
Reference: H00011063-A01
Product name: SOX30 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant SOX30.
Gene id: 11063
Gene name: SOX30
Gene alias: -
Gene description: SRY (sex determining region Y)-box 30
Genbank accession: NM_178424
Immunogen: SOX30 (NP_848511, 644 a.a. ~ 753 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SMPECLSYYEDRYPKHEGIFSTLNRDYSFRDYSSECTHSENSRSCENMNGTSYYNSHSHSGEENLNPVPQLDIGTLENVFTAPTSTPSSIQQVNVTDSDEEEEEKVLRDL
Protein accession: NP_848511
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011063-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011063-A01-1-25-1.jpg
Application image note: SOX30 polyclonal antibody (A01), Lot # 051025JC01 Western Blot analysis of SOX30 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SOX30 polyclonal antibody (A01) now

Add to cart