H00011061-D01_100uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr,IP |
Brand: | Abnova |
Reference: | H00011061-D01 |
Product name: | LECT1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human LECT1 protein. |
Gene id: | 11061 |
Gene name: | LECT1 |
Gene alias: | BRICD3|CHM-I|CHM1 |
Gene description: | leukocyte cell derived chemotaxin 1 |
Genbank accession: | NM_007015.2 |
Immunogen: | LECT1 (NP_008946.1, 1 a.a. ~ 334 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV |
Protein accession: | NP_008946.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LECT1 expression in transfected 293T cell line (H00011061-T01) by LECT1 MaxPab polyclonal antibody. Lane 1: LECT1 transfected lysate(37.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |