LECT1 MaxPab rabbit polyclonal antibody (D01) View larger

LECT1 MaxPab rabbit polyclonal antibody (D01)

H00011061-D01_100uL

New product

384,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LECT1 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about LECT1 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00011061-D01
Product name: LECT1 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human LECT1 protein.
Gene id: 11061
Gene name: LECT1
Gene alias: BRICD3|CHM-I|CHM1
Gene description: leukocyte cell derived chemotaxin 1
Genbank accession: NM_007015.2
Immunogen: LECT1 (NP_008946.1, 1 a.a. ~ 334 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
Protein accession: NP_008946.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00011061-D01-13-15-1.jpg
Application image note: Western Blot analysis of LECT1 expression in transfected 293T cell line (H00011061-T01) by LECT1 MaxPab polyclonal antibody.

Lane 1: LECT1 transfected lysate(37.10 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy LECT1 MaxPab rabbit polyclonal antibody (D01) now

Add to cart