WWP2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

WWP2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WWP2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about WWP2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00011060-D01P
Product name: WWP2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human WWP2 protein.
Gene id: 11060
Gene name: WWP2
Gene alias: AIP2|WWp2-like
Gene description: WW domain containing E3 ubiquitin protein ligase 2
Genbank accession: NM_199423.1
Immunogen: WWP2 (NP_955455.1, 1 a.a. ~ 335 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPG
Protein accession: NP_955455.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00011060-D01P-13-15-1.jpg
Application image note: Western Blot analysis of WWP2 expression in transfected 293T cell line (H00011060-T02) by WWP2 MaxPab polyclonal antibody.

Lane 1: WWP2 transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy WWP2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart