H00011059-M01A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00011059-M01A |
Product name: | WWP1 monoclonal antibody (M01A), clone 1A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant WWP1. |
Clone: | 1A7 |
Isotype: | IgG2a Kappa |
Gene id: | 11059 |
Gene name: | WWP1 |
Gene alias: | AIP5|DKFZp434D2111|Tiul1|hSDRP1 |
Gene description: | WW domain containing E3 ubiquitin protein ligase 1 |
Genbank accession: | NM_007013 |
Immunogen: | WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT |
Protein accession: | NP_008944 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01A), clone 1A7. Lane 1: WWP1 transfected lysate(105.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | The ubiquitin E3 ligase WWP1 increases CXCL12-mediated MDA231 breast cancer cell migration and bone metastasis.Subik K, Shu L, Wu C, Liang Q, Hicks D, Boyce B, Schiffhauer L, Chen D, Chen C, Tang P, Xing L. Bone. 2012 Jan 11. [Epub ahead of print] |