WWP1 monoclonal antibody (M01A), clone 1A7 View larger

WWP1 monoclonal antibody (M01A), clone 1A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WWP1 monoclonal antibody (M01A), clone 1A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about WWP1 monoclonal antibody (M01A), clone 1A7

Brand: Abnova
Reference: H00011059-M01A
Product name: WWP1 monoclonal antibody (M01A), clone 1A7
Product description: Mouse monoclonal antibody raised against a partial recombinant WWP1.
Clone: 1A7
Isotype: IgG2a Kappa
Gene id: 11059
Gene name: WWP1
Gene alias: AIP5|DKFZp434D2111|Tiul1|hSDRP1
Gene description: WW domain containing E3 ubiquitin protein ligase 1
Genbank accession: NM_007013
Immunogen: WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Protein accession: NP_008944
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011059-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011059-M01A-13-15-1.jpg
Application image note: Western Blot analysis of WWP1 expression in transfected 293T cell line by WWP1 monoclonal antibody (M01A), clone 1A7.

Lane 1: WWP1 transfected lysate(105.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: The ubiquitin E3 ligase WWP1 increases CXCL12-mediated MDA231 breast cancer cell migration and bone metastasis.Subik K, Shu L, Wu C, Liang Q, Hicks D, Boyce B, Schiffhauer L, Chen D, Chen C, Tang P, Xing L.
Bone. 2012 Jan 11. [Epub ahead of print]

Reviews

Buy WWP1 monoclonal antibody (M01A), clone 1A7 now

Add to cart