Brand: | Abnova |
Reference: | H00011052-M07 |
Product name: | CPSF6 monoclonal antibody (M07), clone 1C5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CPSF6. |
Clone: | 1C5 |
Isotype: | IgG2b Kappa |
Gene id: | 11052 |
Gene name: | CPSF6 |
Gene alias: | CFIM|CFIM68|HPBRII-4|HPBRII-7 |
Gene description: | cleavage and polyadenylation specific factor 6, 68kDa |
Genbank accession: | NM_007007 |
Immunogen: | CPSF6 (NP_008938, 37 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEAS |
Protein accession: | NP_008938 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | CPSF6 monoclonal antibody (M07), clone 1C5. Western Blot analysis of CPSF6 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |