Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NUDT21 monoclonal antibody (M12), clone 3F8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about NUDT21 monoclonal antibody (M12), clone 3F8
| Brand: | Abnova |
| Reference: | H00011051-M12 |
| Product name: | NUDT21 monoclonal antibody (M12), clone 3F8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NUDT21. |
| Clone: | 3F8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 11051 |
| Gene name: | NUDT21 |
| Gene alias: | CFIM25|CPSF5|DKFZp686H1588 |
| Gene description: | nudix (nucleoside diphosphate linked moiety X)-type motif 21 |
| Genbank accession: | BC001403 |
| Immunogen: | NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN |
| Protein accession: | AAH01403 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (50.71 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NUDT21 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | NUDT21 regulates 3'-UTR length and microRNA-mediated gene silencing in hepatocellular carcinoma.Sun M, Ding J, Li D, Yang G, Cheng Z, Zhu Q. Cancer Lett. 2017 Sep 28;410:158-168. doi: 10.1016/j.canlet.2017.09.026. |