NUDT21 monoclonal antibody (M12), clone 3F8 View larger

NUDT21 monoclonal antibody (M12), clone 3F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDT21 monoclonal antibody (M12), clone 3F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about NUDT21 monoclonal antibody (M12), clone 3F8

Brand: Abnova
Reference: H00011051-M12
Product name: NUDT21 monoclonal antibody (M12), clone 3F8
Product description: Mouse monoclonal antibody raised against a full length recombinant NUDT21.
Clone: 3F8
Isotype: IgG1 Kappa
Gene id: 11051
Gene name: NUDT21
Gene alias: CFIM25|CPSF5|DKFZp686H1588
Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 21
Genbank accession: BC001403
Immunogen: NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Protein accession: AAH01403
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011051-M12-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.71 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011051-M12-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to NUDT21 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: NUDT21 regulates 3'-UTR length and microRNA-mediated gene silencing in hepatocellular carcinoma.Sun M, Ding J, Li D, Yang G, Cheng Z, Zhu Q.
Cancer Lett. 2017 Sep 28;410:158-168. doi: 10.1016/j.canlet.2017.09.026.

Reviews

Buy NUDT21 monoclonal antibody (M12), clone 3F8 now

Add to cart