NUDT21 monoclonal antibody (M01), clone 2G4-6F11 View larger

NUDT21 monoclonal antibody (M01), clone 2G4-6F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUDT21 monoclonal antibody (M01), clone 2G4-6F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about NUDT21 monoclonal antibody (M01), clone 2G4-6F11

Brand: Abnova
Reference: H00011051-M01C
Product name: NUDT21 monoclonal antibody (M01), clone 2G4-6F11
Product description: Mouse monoclonal antibody raised against a full-length recombinant NUDT21.
Clone: 2G4-6F11
Isotype: IgG1 Kappa
Gene id: 11051
Gene name: NUDT21
Gene alias: CFIM25|CPSF5|DKFZp686H1588
Gene description: nudix (nucleoside diphosphate linked moiety X)-type motif 21
Genbank accession: BC001403
Immunogen: NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Protein accession: AAH01403
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy NUDT21 monoclonal antibody (M01), clone 2G4-6F11 now

Add to cart