Brand: | Abnova |
Reference: | H00011046-M03 |
Product name: | SLC35D2 monoclonal antibody (M03), clone 1H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC35D2. |
Clone: | 1H5 |
Isotype: | IgG2a Lambda |
Gene id: | 11046 |
Gene name: | SLC35D2 |
Gene alias: | HFRC1|MGC117215|MGC142139|SQV7L|UGTrel8|hfrc |
Gene description: | solute carrier family 35, member D2 |
Genbank accession: | NM_007001 |
Immunogen: | SLC35D2 (NP_008932, 74 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLT |
Protein accession: | NP_008932 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |