SLC35D2 monoclonal antibody (M03), clone 1H5 View larger

SLC35D2 monoclonal antibody (M03), clone 1H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC35D2 monoclonal antibody (M03), clone 1H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SLC35D2 monoclonal antibody (M03), clone 1H5

Brand: Abnova
Reference: H00011046-M03
Product name: SLC35D2 monoclonal antibody (M03), clone 1H5
Product description: Mouse monoclonal antibody raised against a partial recombinant SLC35D2.
Clone: 1H5
Isotype: IgG2a Lambda
Gene id: 11046
Gene name: SLC35D2
Gene alias: HFRC1|MGC117215|MGC142139|SQV7L|UGTrel8|hfrc
Gene description: solute carrier family 35, member D2
Genbank accession: NM_007001
Immunogen: SLC35D2 (NP_008932, 74 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLT
Protein accession: NP_008932
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011046-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SLC35D2 monoclonal antibody (M03), clone 1H5 now

Add to cart