POLS monoclonal antibody (M01), clone 2F8 View larger

POLS monoclonal antibody (M01), clone 2F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POLS monoclonal antibody (M01), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,RNAi-Ab

More info about POLS monoclonal antibody (M01), clone 2F8

Brand: Abnova
Reference: H00011044-M01
Product name: POLS monoclonal antibody (M01), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant POLS.
Clone: 2F8
Isotype: IgG2b Kappa
Gene id: 11044
Gene name: POLS
Gene alias: LAK-1|POLK|TRF4|TRF4-1
Gene description: polymerase (DNA directed) sigma
Genbank accession: NM_006999
Immunogen: POLS (NP_008930, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Protein accession: NP_008930
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011044-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011044-M01-42-R01V-1.jpg
Application image note: Western blot analysis of POLS over-expressed 293 cell line, cotransfected with POLS Validated Chimera RNAi ( Cat # H00011044-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with POLS monoclonal antibody (M01), clone 2F8 (Cat # H00011044-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy POLS monoclonal antibody (M01), clone 2F8 now

Add to cart