B4GAT1 monoclonal antibody (M03), clone 2H6 View larger

B4GAT1 monoclonal antibody (M03), clone 2H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of B4GAT1 monoclonal antibody (M03), clone 2H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about B4GAT1 monoclonal antibody (M03), clone 2H6

Brand: Abnova
Reference: H00011041-M03
Product name: B4GAT1 monoclonal antibody (M03), clone 2H6
Product description: Mouse monoclonal antibody raised against a partial recombinant B4GAT1.
Clone: 2H6
Isotype: IgG2b Kappa
Gene id: 11041
Gene name: B4GAT1
Gene alias: B3GN-T1|B3GNT6|BETA3GNTI|iGAT|iGNT
Gene description: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1
Genbank accession: NM_006876
Immunogen: B4GAT1 (NP_006867.1, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC
Protein accession: NP_006867.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011041-M03-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged B4GAT1 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy B4GAT1 monoclonal antibody (M03), clone 2H6 now

Add to cart