SMA4 (Human) Recombinant Protein (P03) View larger

SMA4 (Human) Recombinant Protein (P03)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SMA4 (Human) Recombinant Protein (P03)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SMA4 (Human) Recombinant Protein (P03)

Brand: Abnova
Reference: H00011039-P03
Product name: SMA4 (Human) Recombinant Protein (P03)
Product description: Human SMA4 full-length ORF ( AAH02622.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 11039
Gene name: SMA4
Gene alias: FLJ36702|MGC22265|MGC60382|SMA3|b55C20.2
Gene description: glucuronidase, beta pseudogene
Genbank accession: BC002622.1
Immunogen sequence/protein sequence: MDRSNPVKPALDYFSNRLVNYQISVKCSNQFKLEVCLLNAENKVVDNQAGTQGQLKVLGANLWWPYLMHEHPAYLYSWEDGDCSHQSLGPLPACDLCDQLHLRSRQGGSVCGCDPCEQLLLLVSQLRAPGVDSAAAGRPV
Protein accession: AAH02622.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00011039-P03-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SMA4 (Human) Recombinant Protein (P03) now

Add to cart