Brand: | Abnova |
Reference: | H00011037-M01 |
Product name: | SBLF monoclonal antibody (M01), clone 1F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SBLF. |
Clone: | 1F3 |
Isotype: | IgG2a Kappa |
Gene id: | 11037 |
Gene name: | STON1 |
Gene alias: | DKFZp781K2462|MGC149803|MGC149804|SBLF|STN1|STNB1|stoned-b1 |
Gene description: | stonin 1 |
Genbank accession: | NM_006873 |
Immunogen: | SBLF (NP_006864, 529 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG |
Protein accession: | NP_006864 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged STON1 is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |