SBLF monoclonal antibody (M01), clone 1F3 View larger

SBLF monoclonal antibody (M01), clone 1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SBLF monoclonal antibody (M01), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about SBLF monoclonal antibody (M01), clone 1F3

Brand: Abnova
Reference: H00011037-M01
Product name: SBLF monoclonal antibody (M01), clone 1F3
Product description: Mouse monoclonal antibody raised against a partial recombinant SBLF.
Clone: 1F3
Isotype: IgG2a Kappa
Gene id: 11037
Gene name: STON1
Gene alias: DKFZp781K2462|MGC149803|MGC149804|SBLF|STN1|STNB1|stoned-b1
Gene description: stonin 1
Genbank accession: NM_006873
Immunogen: SBLF (NP_006864, 529 a.a. ~ 620 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SLKSVVVVQGAYVELQAFVNMASLAQRSSYAGSLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVG
Protein accession: NP_006864
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011037-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged STON1 is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy SBLF monoclonal antibody (M01), clone 1F3 now

Add to cart