Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALF monoclonal antibody (M05), clone 3E4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,ELISA,WB-Re,WB-Tr |
More info about ALF monoclonal antibody (M05), clone 3E4
| Brand: | Abnova |
| Reference: | H00011036-M05 |
| Product name: | ALF monoclonal antibody (M05), clone 3E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ALF. |
| Clone: | 3E4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 11036 |
| Gene name: | GTF2A1L |
| Gene alias: | ALF|MGC26254 |
| Gene description: | general transcription factor IIA, 1-like |
| Genbank accession: | NM_006872 |
| Immunogen: | ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQ |
| Protein accession: | NP_006863 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ALF expression in transfected 293T cell line by ALF monoclonal antibody (M05), clone 3E4. Lane 1: ALF transfected lysate(52.4 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |