ALF monoclonal antibody (M04), clone 5B9 View larger

ALF monoclonal antibody (M04), clone 5B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALF monoclonal antibody (M04), clone 5B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about ALF monoclonal antibody (M04), clone 5B9

Brand: Abnova
Reference: H00011036-M04
Product name: ALF monoclonal antibody (M04), clone 5B9
Product description: Mouse monoclonal antibody raised against a partial recombinant ALF.
Clone: 5B9
Isotype: IgG2b Kappa
Gene id: 11036
Gene name: GTF2A1L
Gene alias: ALF|MGC26254
Gene description: general transcription factor IIA, 1-like
Genbank accession: NM_006872
Immunogen: ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQ
Protein accession: NP_006863
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011036-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00011036-M04-1-11-1.jpg
Application image note: ALF monoclonal antibody (M04), clone 5B9 Western Blot analysis of ALF expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ALF monoclonal antibody (M04), clone 5B9 now

Add to cart