ALF monoclonal antibody (M03), clone 6F5 View larger

ALF monoclonal antibody (M03), clone 6F5

H00011036-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALF monoclonal antibody (M03), clone 6F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,IP

More info about ALF monoclonal antibody (M03), clone 6F5

Brand: Abnova
Reference: H00011036-M03
Product name: ALF monoclonal antibody (M03), clone 6F5
Product description: Mouse monoclonal antibody raised against a partial recombinant ALF.
Clone: 6F5
Isotype: IgG1 Kappa
Gene id: 11036
Gene name: GTF2A1L
Gene alias: ALF|MGC26254
Gene description: general transcription factor IIA, 1-like
Genbank accession: NM_006872
Immunogen: ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQ
Protein accession: NP_006863
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011036-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011036-M03-31-15-1.jpg
Application image note: Immunoprecipitation of GTF2A1L transfected lysate using anti-GTF2A1L monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GTF2A1L MaxPab rabbit polyclonal antibody.
Applications: ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy ALF monoclonal antibody (M03), clone 6F5 now

Add to cart