ALF monoclonal antibody (M02), clone 2E3 View larger

ALF monoclonal antibody (M02), clone 2E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALF monoclonal antibody (M02), clone 2E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re,IP

More info about ALF monoclonal antibody (M02), clone 2E3

Brand: Abnova
Reference: H00011036-M02
Product name: ALF monoclonal antibody (M02), clone 2E3
Product description: Mouse monoclonal antibody raised against a partial recombinant ALF.
Clone: 2E3
Isotype: IgG1 Kappa
Gene id: 11036
Gene name: GTF2A1L
Gene alias: ALF|MGC26254
Gene description: general transcription factor IIA, 1-like
Genbank accession: NM_006872
Immunogen: ALF (NP_006863, 251 a.a. ~ 348 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PQVSQTNSNVESVLSGSASMAQNLHDESLSTSPHGALHQHVTDIQLHILKNRMYGCDSVKQPRNIEEPSNIPVSEKDSNSQVDLSIRVTDDDIGEIIQ
Protein accession: NP_006863
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011036-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011036-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to GTF2A1L on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re,IP
Shipping condition: Dry Ice

Reviews

Buy ALF monoclonal antibody (M02), clone 2E3 now

Add to cart