RAB31 monoclonal antibody (M03), clone 4D12 View larger

RAB31 monoclonal antibody (M03), clone 4D12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB31 monoclonal antibody (M03), clone 4D12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about RAB31 monoclonal antibody (M03), clone 4D12

Brand: Abnova
Reference: H00011031-M03
Product name: RAB31 monoclonal antibody (M03), clone 4D12
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB31.
Clone: 4D12
Isotype: IgG2a Kappa
Gene id: 11031
Gene name: RAB31
Gene alias: Rab22B
Gene description: RAB31, member RAS oncogene family
Genbank accession: BC001148
Immunogen: RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Protein accession: AAH01148
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011031-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011031-M03-1-25-1.jpg
Application image note: RAB31 monoclonal antibody (M03), clone 4D12. Western Blot analysis of RAB31 expression in Hela S3 NE(Cat # L013V3 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: p75 neurotrophin receptor regulates glucose homeostasis and insulin sensitivity.Baeza-Raja B, Li P, Le Moan N, Sachs BD, Schachtrup C, Davalos D, Vagena E, Bridges D, Kim C, Saltiel AR, Olefsky JM, Akassoglou K.
Proc Natl Acad Sci U S A. 2012 Apr 10;109(15):5838-43. Epub 2012 Mar 28.

Reviews

Buy RAB31 monoclonal antibody (M03), clone 4D12 now

Add to cart