Brand: | Abnova |
Reference: | H00011031-M03 |
Product name: | RAB31 monoclonal antibody (M03), clone 4D12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB31. |
Clone: | 4D12 |
Isotype: | IgG2a Kappa |
Gene id: | 11031 |
Gene name: | RAB31 |
Gene alias: | Rab22B |
Gene description: | RAB31, member RAS oncogene family |
Genbank accession: | BC001148 |
Immunogen: | RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC |
Protein accession: | AAH01148 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAB31 monoclonal antibody (M03), clone 4D12. Western Blot analysis of RAB31 expression in Hela S3 NE(Cat # L013V3 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | p75 neurotrophin receptor regulates glucose homeostasis and insulin sensitivity.Baeza-Raja B, Li P, Le Moan N, Sachs BD, Schachtrup C, Davalos D, Vagena E, Bridges D, Kim C, Saltiel AR, Olefsky JM, Akassoglou K. Proc Natl Acad Sci U S A. 2012 Apr 10;109(15):5838-43. Epub 2012 Mar 28. |