Brand: | Abnova |
Reference: | H00011031-M01 |
Product name: | RAB31 monoclonal antibody (M01), clone 1C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB31. |
Clone: | 1C6 |
Isotype: | IgG2a Kappa |
Gene id: | 11031 |
Gene name: | RAB31 |
Gene alias: | Rab22B |
Gene description: | RAB31, member RAS oncogene family |
Genbank accession: | BC001148 |
Immunogen: | RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC |
Protein accession: | AAH01148 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Gapex-5, a Rab31 Guanine Nucleotide Exchange Factor that Regulates Glut4 Trafficking in Adipocytes.Lodhi IJ, Chiang SH, Chang L, Vollenweider D, Watson RT, Inoue M, Pessin JE, Saltiel AR. Cell Metab. 2007 Jan;5(1):59-72. |