RAB31 monoclonal antibody (M01), clone 1C6 View larger

RAB31 monoclonal antibody (M01), clone 1C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB31 monoclonal antibody (M01), clone 1C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RAB31 monoclonal antibody (M01), clone 1C6

Brand: Abnova
Reference: H00011031-M01
Product name: RAB31 monoclonal antibody (M01), clone 1C6
Product description: Mouse monoclonal antibody raised against a partial recombinant RAB31.
Clone: 1C6
Isotype: IgG2a Kappa
Gene id: 11031
Gene name: RAB31
Gene alias: Rab22B
Gene description: RAB31, member RAS oncogene family
Genbank accession: BC001148
Immunogen: RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Protein accession: AAH01148
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011031-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Gapex-5, a Rab31 Guanine Nucleotide Exchange Factor that Regulates Glut4 Trafficking in Adipocytes.Lodhi IJ, Chiang SH, Chang L, Vollenweider D, Watson RT, Inoue M, Pessin JE, Saltiel AR.
Cell Metab. 2007 Jan;5(1):59-72.

Reviews

Buy RAB31 monoclonal antibody (M01), clone 1C6 now

Add to cart