RAB31 purified MaxPab rabbit polyclonal antibody (D01P) View larger

RAB31 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB31 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about RAB31 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00011031-D01P
Product name: RAB31 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human RAB31 protein.
Gene id: 11031
Gene name: RAB31
Gene alias: Rab22B
Gene description: RAB31, member RAS oncogene family
Genbank accession: BC001148.1
Immunogen: RAB31 (AAH01148.1, 1 a.a. ~ 195 a.a) full-length human protein.
Immunogen sequence/protein sequence: MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Protein accession: AAH01148.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00011031-D01P-13-15-1.jpg
Application image note: Western Blot analysis of RAB31 expression in transfected 293T cell line (H00011031-T01) by RAB31 MaxPab polyclonal antibody.

Lane 1: RAB31 transfected lysate(21.45 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB31 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart