LILRA2 monoclonal antibody (M14), clone 4D7 View larger

LILRA2 monoclonal antibody (M14), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LILRA2 monoclonal antibody (M14), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about LILRA2 monoclonal antibody (M14), clone 4D7

Brand: Abnova
Reference: H00011027-M14
Product name: LILRA2 monoclonal antibody (M14), clone 4D7
Product description: Mouse monoclonal antibody raised against a full-length recombinant LILRA2.
Clone: 4D7
Isotype: IgG2a Kappa
Gene id: 11027
Gene name: LILRA2
Gene alias: CD85H|ILT1|LIR-7|LIR7
Gene description: leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
Genbank accession: BC027916
Immunogen: LILRA2 (AAH27916, 1 a.a. ~ 466 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIAREHAGRYHCQYYSHNHSSEYSDPLELVVTGAYGKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR
Protein accession: AAH27916
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011027-M14-13-15-1.jpg
Application image note: Western Blot analysis of LILRA2 expression in transfected 293T cell line by LILRA2 monoclonal antibody (M14), clone 4D7.

Lane 1: LILRA2 transfected lysate (Predicted MW: 51.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LILRA2 monoclonal antibody (M14), clone 4D7 now

Add to cart