Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00011027-M14 |
Product name: | LILRA2 monoclonal antibody (M14), clone 4D7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant LILRA2. |
Clone: | 4D7 |
Isotype: | IgG2a Kappa |
Gene id: | 11027 |
Gene name: | LILRA2 |
Gene alias: | CD85H|ILT1|LIR-7|LIR7 |
Gene description: | leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2 |
Genbank accession: | BC027916 |
Immunogen: | LILRA2 (AAH27916, 1 a.a. ~ 466 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIAREHAGRYHCQYYSHNHSSEYSDPLELVVTGAYGKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR |
Protein accession: | AAH27916 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LILRA2 expression in transfected 293T cell line by LILRA2 monoclonal antibody (M14), clone 4D7. Lane 1: LILRA2 transfected lysate (Predicted MW: 51.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Tr |
Shipping condition: | Dry Ice |