LILRA3 monoclonal antibody (M01), clone 2E9 View larger

LILRA3 monoclonal antibody (M01), clone 2E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LILRA3 monoclonal antibody (M01), clone 2E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about LILRA3 monoclonal antibody (M01), clone 2E9

Brand: Abnova
Reference: H00011026-M01
Product name: LILRA3 monoclonal antibody (M01), clone 2E9
Product description: Mouse monoclonal antibody raised against a full length recombinant LILRA3.
Clone: 2E9
Isotype: IgG1 Kappa
Gene id: 11026
Gene name: LILRA3
Gene alias: CD85E|HM31|HM43|ILT6|LIR-4|LIR4|e3
Gene description: leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
Genbank accession: BC028208
Immunogen: LILRA3 (AAH28208.1, 1 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Protein accession: AAH28208.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011026-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (74.03 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011026-M01-13-15-1.jpg
Application image note: Western Blot analysis of LILRA3 expression in transfected 293T cell line by LILRA3 monoclonal antibody (M01), clone 2E9.

Lane 1: LILRA3 transfected lysate(50.485 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Glycosylation in a mammalian expression system is critical for the production of functionally active leukocyte immunoglobulin-like receptor A3 protein.Lee TH, Mitchell A, Liu Lau S, An H, Rajeaskariah P, Wasinger V, Raftery M, Bryant K, Tedla N
J Biol Chem. 2013 Sep 30.

Reviews

Buy LILRA3 monoclonal antibody (M01), clone 2E9 now

Add to cart