LILRA3 purified MaxPab mouse polyclonal antibody (B01P) View larger

LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00011026-B01P
Product name: LILRA3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LILRA3 protein.
Gene id: 11026
Gene name: LILRA3
Gene alias: CD85E|HM31|HM43|ILT6|LIR-4|LIR4|e3
Gene description: leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
Genbank accession: NM_006865.2
Immunogen: LILRA3 (NP_006856.2, 1 a.a. ~ 439 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Protein accession: NP_006856.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011026-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LILRA3 expression in transfected 293T cell line (H00011026-T01) by LILRA3 MaxPab polyclonal antibody.

Lane 1: LILRA3 transfected lysate(48.29 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LILRA3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart