TMSB15A monoclonal antibody (M01), clone 6D10 View larger

TMSB15A monoclonal antibody (M01), clone 6D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TMSB15A monoclonal antibody (M01), clone 6D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about TMSB15A monoclonal antibody (M01), clone 6D10

Brand: Abnova
Reference: H00011013-M01
Product name: TMSB15A monoclonal antibody (M01), clone 6D10
Product description: Mouse monoclonal antibody raised against a full-length recombinant TMSB15A.
Clone: 6D10
Isotype: IgG1 Kappa
Gene id: 11013
Gene name: TMSB15A
Gene alias: TMSL8|TMSNB|Tb15|TbNB
Gene description: thymosin beta 15a
Genbank accession: NM_021992.2
Immunogen: TMSB15A (NP_068832.1, 1 a.a. ~ 45 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSDKPDLSEVEKFDRSKLKKTNTEEKNTLPSKETIQQEKECVQTS
Protein accession: NP_068832.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011013-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.6 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011013-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged TMSB15A is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TMSB15A monoclonal antibody (M01), clone 6D10 now

Add to cart