Brand: | Abnova |
Reference: | H00011010-M04 |
Product name: | GLIPR1 monoclonal antibody (M04), clone 8D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GLIPR1. |
Clone: | 8D9 |
Isotype: | IgG2a Kappa |
Gene id: | 11010 |
Gene name: | GLIPR1 |
Gene alias: | CRISP7|GLIPR|RTVP1 |
Gene description: | GLI pathogenesis-related 1 |
Genbank accession: | NM_006851 |
Immunogen: | GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN |
Protein accession: | NP_006842 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GLIPR1 monoclonal antibody (M04), clone 8D9. Western Blot analysis of GLIPR1 expression in HeLa(Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |