GLIPR1 monoclonal antibody (M04), clone 8D9 View larger

GLIPR1 monoclonal antibody (M04), clone 8D9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLIPR1 monoclonal antibody (M04), clone 8D9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about GLIPR1 monoclonal antibody (M04), clone 8D9

Brand: Abnova
Reference: H00011010-M04
Product name: GLIPR1 monoclonal antibody (M04), clone 8D9
Product description: Mouse monoclonal antibody raised against a partial recombinant GLIPR1.
Clone: 8D9
Isotype: IgG2a Kappa
Gene id: 11010
Gene name: GLIPR1
Gene alias: CRISP7|GLIPR|RTVP1
Gene description: GLI pathogenesis-related 1
Genbank accession: NM_006851
Immunogen: GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Protein accession: NP_006842
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011010-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011010-M04-1-1-1.jpg
Application image note: GLIPR1 monoclonal antibody (M04), clone 8D9. Western Blot analysis of GLIPR1 expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GLIPR1 monoclonal antibody (M04), clone 8D9 now

Add to cart