GLIPR1 polyclonal antibody (A01) View larger

GLIPR1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLIPR1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about GLIPR1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00011010-A01
Product name: GLIPR1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant GLIPR1.
Gene id: 11010
Gene name: GLIPR1
Gene alias: CRISP7|GLIPR|RTVP1
Gene description: GLI pathogenesis-related 1
Genbank accession: NM_006851
Immunogen: GLIPR1 (NP_006842, 23 a.a. ~ 99 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Protein accession: NP_006842
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00011010-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011010-A01-1-23-1.jpg
Application image note: GLIPR1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of GLIPR1 expression in U-2 OS ( Cat # L022V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GLIPR1 polyclonal antibody (A01) now

Add to cart