Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL24 (Human) Recombinant Protein (P02)
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Human |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about IL24 (Human) Recombinant Protein (P02)
| Product description: | Human IL24 full-length ORF ( NP_006841.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 11009 |
| Gene name: | IL24 |
| Gene alias: | C49A|FISP|IL-24|IL10B|MDA7|Mob-5|ST16|mda-7 |
| Gene description: | interleukin 24 |
| Genbank accession: | NM_006850.2 |
| Immunogen sequence/protein sequence: | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL |
| Protein accession: | NP_006841.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Size: | 10 ug |
| Shipping condition: | Dry Ice |