IL24 purified MaxPab mouse polyclonal antibody (B01P) View larger

IL24 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL24 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about IL24 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00011009-B01P
Product name: IL24 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IL24 protein.
Gene id: 11009
Gene name: IL24
Gene alias: C49A|FISP|IL-24|IL10B|MDA7|Mob-5|ST16|mda-7
Gene description: interleukin 24
Genbank accession: NM_006850
Immunogen: IL24 (NP_006841.1, 1 a.a. ~ 206 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Protein accession: NP_006841.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00011009-B01P-13-15-1.jpg
Application image note: Western Blot analysis of IL24 expression in transfected 293T cell line (H00011009-T01) by IL24 MaxPab polyclonal antibody.

Lane 1: IL24 transfected lysate(22.66 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL24 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart